Product Certification&
Enterprise Certification
Country: China (Mainland)
Business Type:Trading Company
Tel: 15028179902
Mobile: 15028179902
Tel: 15028179902
Fax:
Province/state: Hebei
City: shijiazhuang
Street: room 1401,A building,Enjoy city,shijiazhuang city,hebei province,China
MaxCard:
CAS NO.52232-67-4
1(1-25)Kilogram1(500-1000)Kilogram3(1-25)Kilogram
Company information:
Hebei Mojin Biotechnology Co., Ltd, Our company is a professional in chemical raw materials and chemical reagents research and development production enterprises. Our business covers more than 30 countries, most of the big customers come from Europe, America and other countries in the world, we can guarantee the quality and price. In recent decades, with the efforts of all employees, we have established many cooperative companies in shandong, henan, guangdong and other places. Our corporate purpose is based on the market, enhance the strength, take the road of scientific and environmental sustainable development, relying on the country. Technology r & d center, increase the investment in r & d, based on the domestic market, expand the international market, manufacturing quality products, sincere service to the society, into a modern, ecological, scientific and technological enterprise world.
Quality:
Our products have good quality and we have many old customers.
Manufacturer technologly:
Our technology person is professinal with the chemical products,which is qualified with many standrad.
Price:
Our price is lowest and compective,if you have any needs,please don't hesitate to contact me.
Our service:
1.we are online 24 hours,can reply your message immediately.
2.we have good price and many kind of chemicals,can meet your needs.
3.we have goods in stock,can send out goods asap after you make the payment.is
4.our payment term is varoius,you can choose what you want.
Teriparatide acetate CAS 52232-67-4
Teriparatide acetate CAS 52232-67-4
Teriparatide acetate CAS 52232-67-4
Teriparatide acetate CAS 52232-67-4
Teriparatide acetate CAS 52232-67-4
Product Name: | Teriparatide acetate |
Synonyms: | PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE |
CAS: | 52232-67-4 |
MF: | C172H278N52O47S2 |
MW: | 3890.49792 |
EINECS: | 640-978-1 |
Product Categories: | Amino Acid Derivatives;EndocrinologyandHormones;Peptide;Hormones;Other Protein/Peptide Hormones;proteins;Parathyroid Hormone (PTH)Peptides and Proteins;Parathyroid Hormone Fragments;Peptides for Cell Biology;Peptides and Proteins;Various Peptides;52232-67-4 |
Mol File: | 52232-67-4.mol |
Company name:Hebei Mojin Biotechnology Co.,Ltd.
Established time:2017
Main field: chemical
Hebei Mojin Biotechnology Co., Ltd, Our company is a professional in chemical raw materials and chemical reagents research and development production enterprises. Our business covers more than 30 countries,
most of the big customers come from Europe, America and other countries in the world, we can guarantee the quality and price. In recent decades, with the efforts of all employees, we have established many cooperative companies in shandong, henan, guangdong and other places. Our corporate purpose is based on the market, enhance the strength, take the road of scientific and environmental sustainable development, relying on the country. Technology r & d center, increase
the investment in r & d, based on the domestic market, expand the international market, manufacturing quality products, sincere service to the society, into a modern, ecological, scientific
and technological enterprise world.
Product usage:
Industrial use
Picture of our company.
Product picture
Packing
25KG drum
Immediately shipping after you confirm the order.Prom
Shipping method:by sea or by air or by express
Advantage
1.we are online 24 hours,can reply your message immediately.
2.we have good price and many kind of chemicals,can meet your needs.
3.we have goods in stock,can send out goods asap after you make the payment.is
4.our payment term is varoius,you can choose what you want.
Supply ability:
5000kg/week