Welcome to LookChem.com Sign In|Join Free

Hebei Mujin Biotechnology Co.,Ltd

Assessed Supplier Enterprise Certification

Assessed
Supplier
6th
years
Home>>Products>>15mg 20mg Teriparatide acetate CAS 52232-67-4

Product Certification&
Enterprise Certification

More Detail

Hebei Mujin Biotechnology Co.,Ltd

Country: China (Mainland)

Business Type:Trading Company

Ms.bella gao

Tel: 15028179902

Mobile: 15028179902

Tel: 15028179902

Fax:

URL: http://www.hbmojin.com

Province/state: Hebei

City: shijiazhuang

Street: room 1401,A building,Enjoy city,shijiazhuang city,hebei province,China

MaxCard:


qq
    x
  • Ms.betty
  • Ms.may
Contact Suppliers

15mg 20mg Teriparatide acetate CAS 52232-67-4

CAS NO.52232-67-4

  • FOB Price: USD: 20.00-30.00 /Kilogram Get Latest Price
  • Min.Order: 1 Kilogram
  • Payment Terms: T/T
  • Available Specifications:

    1(1-25)Kilogram1(500-1000)Kilogram3(1-25)Kilogram

Contact Supplier

Product Details

Keywords

  • Teriparatide acetate
  • 52232-67-4
  • CAS 52232-67-4

Quick Details

  • ProName: Teriparatide acetate CAS 52232-67-4
  • CasNo: 52232-67-4
  • Molecular Formula: C181H291N55O51S2
  • Appearance: white powder
  • Application: industrial use
  • DeliveryTime: within 10 days
  • PackAge: 5mg,10mg,15mg,20mg 10vials one box
  • Port: qingdao/tianjin
  • ProductionCapacity: 50000 Kilogram/Month
  • Purity: 99%
  • Storage: cool and dry place
  • Transportation: by sea or by air
  • LimitNum: 1 Kilogram
  • Heavy metal: 1
  • Grade: Industrial Grade,Food Grade,Pharma Gra...
  • Appearance: white powder

Superiority

Company information:

Hebei Mojin Biotechnology Co., Ltd, Our company is a professional in chemical raw materials and chemical reagents research and development production enterprises. Our business covers more than 30 countries, most of the big customers come from Europe, America and other countries in the world, we can guarantee the quality and price. In recent decades, with the efforts of all employees, we have established many cooperative companies in shandong, henan, guangdong and other places. Our corporate purpose is based on the market, enhance the strength, take the road of scientific and environmental sustainable development, relying on the country. Technology r & d center, increase the investment in r & d, based on the domestic market, expand the international market, manufacturing quality products, sincere service to the society, into a modern, ecological, scientific and technological enterprise world.

Quality:

Our products have good quality and we have many old customers.

Manufacturer technologly:

Our technology person is professinal with the chemical products,which is qualified with many standrad.

Price:

Our price is lowest and compective,if you have any needs,please don't hesitate to contact me.

Our service:

1.we are online 24 hours,can reply your message immediately.

2.we have good price and many kind of chemicals,can meet your needs.

3.we have goods in stock,can send out goods asap after you make the payment.is 

4.our payment term is varoius,you can choose what you want.

 

Details

15mg 20mg Teriparatide acetate CAS 52232-67-4

15mg 20mg Teriparatide acetate CAS 52232-67-4

15mg 20mg Teriparatide acetate CAS 52232-67-4

15mg 20mg Teriparatide acetate CAS 52232-67-4

15mg 20mg Teriparatide acetate CAS 52232-67-4

Product Name: Teriparatide acetate
Synonyms: PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE
CAS: 52232-67-4
MF: C172H278N52O47S2
MW: 3890.49792
EINECS: 640-978-1
Product Categories: Amino Acid Derivatives;EndocrinologyandHormones;Peptide;Hormones;Other Protein/Peptide Hormones;proteins;Parathyroid Hormone (PTH)Peptides and Proteins;Parathyroid Hormone Fragments;Peptides for Cell Biology;Peptides and Proteins;Various Peptides;52232-67-4
Mol File: 52232-67-4.mol

Company name:Hebei Mojin Biotechnology Co.,Ltd.

Established time:2017

Main field: chemical

Hebei Mojin Biotechnology Co., Ltd, Our company is a professional in  chemical raw materials and chemical reagents research and development production enterprises. Our business covers more than 30 countries,

most of the big customers come from Europe, America and other countries in the world, we can guarantee the quality and price. In recent decades, with the efforts of all employees, we have established many cooperative companies in shandong, henan, guangdong and other places. Our corporate purpose is based on the market, enhance the strength, take the road of scientific and environmental sustainable development, relying on the country. Technology r & d center, increase

the investment in r & d, based on the domestic market, expand the international market, manufacturing quality products, sincere service to the society, into a modern, ecological, scientific

and technological enterprise world.

Product usage:

Industrial use

Picture of our company.

 

Product picture

Packing

25KG drum

Immediately shipping after you confirm the order.Prom

Shipping method:by sea or by air or by express

Advantage

1.we are online 24 hours,can reply your message immediately.

2.we have good price and many kind of chemicals,can meet your needs.

3.we have goods in stock,can send out goods asap after you make the payment.is 

4.our payment term is varoius,you can choose what you want.

Supply ability:

5000kg/week