Product Certification&
Enterprise Certification
Country: China (Mainland)
Business Type:Trading Company
Tel: 13315457394
Mobile: 13315457394
Tel: 13315457394
Fax:
Province/state: Hebei
City: shijiazhuang
Street: room 1401,A building,Enjoy city,shijiazhuang city,hebei province,China
MaxCard:
CAS NO.52232-67-4
一级(10-100)Kilogram一级(100-1000)Kilogram二级(10-100)Kilogram二级(100-1000)Kilogram
Our company have high quality product , and also the product we have good manufacture .
This product is of fine quality. Every finish should be checked by quality inspection system.
We can ensure the product quality , If the product is not satisfactory, you can return it at any time.
In the chemical industry, the process of producing a chemical product. Including raw material pretreatment, reactant chemical reaction and chemical product separation purification, final packaging sales.
Price
Our product have resonable price and good service high quality and inexpensive, you deserve.every webiste we have the sales point, your purchase is convenient.
Our service
1.we are online 24 hours,can reply your message immediately.
2.we have good price and many kind of chemicals,can meet your needs.
3.we have goods in stock,can send out goods asap after you make the payment.is
4.our payment term is varoius,you can choose what you want.
Product Information
Teriparatide acetate Basic information |
Product Name: | Teriparatide acetate |
Synonyms: | PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE |
CAS: | 52232-67-4 |
MF: | C172H278N52O47S2 |
MW: | 3890.49792 |
EINECS: | 640-978-1 |
Product Categories: | Amino Acid Derivatives;EndocrinologyandHormones;Peptide;Hormones;Other Protein/Peptide Hormones;proteins;Parathyroid Hormone (PTH)Peptides and Proteins;Parathyroid Hormone Fragments;Peptides for Cell Biology;Peptides and Proteins;Various Peptides;52232-67-4 |
Mol File: | 52232-67-4.mol |
Teriparatide acetate Chemical Properties |
Melting point | >205oC (dec.) |
RTECS | SQ7770000 |
storage temp. | −20°C |
solubility | DMSO (Slightly), Water (Slightly) |
form | powder |
color | White to Off-White |
biological source | human |
Water Solubility | Soluble to 0.40 mg/ml in water |
Sequence | H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH |
Stability: | Hygroscopic |
CAS DataBase Reference | 52232-67-4(CAS DataBase Reference) |
Description | The anabolic drug teriparatide acetate (TA), known as recombinant human parathyroid hormone 1–34, which directly promotes bone formation by generating new osteocytes, has been introduced as a novel therapeutic agent for osteoporosis. Distinct from antiresorptive drug treatment, patients with osteonecrosis of the jaw showed successful clinical outcomes after weekly administration of TA. In addition, adverse outcomes of long-term bisphosphonate treatment, such as bone fracture, were healed after usage of TA, and better bone mass and mineral density improvements at the lumbar spine and femoral neck were achieved with TA treatment than with bisphosphonate treatment[1]. |
Uses | A fragment of human parathyroid hormone (hPTH) peptide sequence containing the 34 N-terminal residues of hPTH. This fragment was also found to be an agonist at PTH1 and PTH2 receptors. |
Product Picture
Packing& shipping& Payment
Packing:5mg/10mg/15mg/20mg/30mg/60mg bottle,etc
Shipping:by sea or by air
Payment:T/T,,moneygram,bitcoin
Small quantity | Bottle |
Bulk quantity | Box |
Others | Can do your package or split small packages according to your request |
5MG/10MG/15MG/20MG/30MG/60MG Bottle. |
Shipping:
By Courier: Fedex, EMS, DHL, TNT, UPS, etc. 7-10 days product will reach you after payment received, if it's agreed as ready stock before order.
By air, airport to airport
By sea
Company Information
Hebei Mojin Biotechnology Co., Ltd, our business covers more than 30 countries, most of the big customers come from Europe, America and other countries in the world, we can guarantee the quality and price. In recent decades, with the efforts of all employees, we have established many cooperative companies in shandong, henan, guangdong and other places. Our corporate purpose is based on the market, enhance the strength, take the road of scientific and environmental sustainable development, relying on the country. Technology r & d center, increase the investment in r & d, based on the domestic market, expand the international market, manufacturing quality products, sincere service to the society, into a modern, ecological, scientific and technological enterprise world.